PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011098430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 201aa    MW: 21740.1 Da    PI: 7.1343
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011098430.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.81.9e-4315113199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC ++C++apyfp e+p kf nvhk+FGasnv+kll+++p+++reda++sl+yeA+ar++dPvyG+vg i+ lq+q+ +l++el+
  XP_011098430.1  15 PCAACKFLRRKCLPGCIFAPYFPPEEPTKFVNVHKIFGASNVSKLLNEIPPHQREDAVNSLAYEADARLKDPVYGCVGAISVLQRQVLNLQKELD 109
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_011098430.1 110 ATNA 113
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.27614115IPR004883Lateral organ boundaries, LOB
PfamPF031956.0E-4315112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MMASSSSSSG YSNPPCAACK FLRRKCLPGC IFAPYFPPEE PTKFVNVHKI FGASNVSKLL  60
NEIPPHQRED AVNSLAYEAD ARLKDPVYGC VGAISVLQRQ VLNLQKELDA TNADLMRFVG  120
NDHNPYHPDP AHVSMNLIIN SNQQRSGNSS RNYGHGFGRR VDFGSGSFDP NSGFSPYSSC  180
PWNTGHPGDQ GPDAGGDSCS S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098429.11e-149PREDICTED: LOB domain-containing protein 25
RefseqXP_011098430.11e-149PREDICTED: LOB domain-containing protein 25
SwissprotQ8L8Q34e-67LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A068U1816e-76A0A068U181_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000178057e-74(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.12e-67LOB domain-containing protein 25